Obs: Detta innehåll finns inte tillgängligt på svenska. Därför ser du engelska versionen. Om du tycker att denna sida borde översättas till svenska, kan du skriva till oss på support.trafiklab.se.

Om du vill se webbsidan på engelska, klicka här.

NeTEx regional is a set of NeTEx feeds of high quality. These feeds contain all data present in GTFS Regional, as well as additional data which can’t be represented in GTFS.

What does this dataset contain?

This dataset contains high quality detailed data, both static and real-time, in the NeTEx format. Each dataset contains data for a specific region or operator.

Data format

The data is in the NeTEx (Network and Timetable Exchange) format. This is a format in which all European operators have to publish their data. The data is aimed at both operator-to-traveller communication and internal communication between different organizations. Samtrafiken follows the Nordic NeTEx Profile, which is documented by Entur.

For more technical information about the NeTEx dataset that is provided on Trafiklab, please visit Samtrafiken Open Data - NeTEx.

Updates

The static data in this dataset is updated on a daily basis, typically between 03:00 and 07:00.

Operators covered by this dataset

The following table shows which operators are covered by this dataset.

New! Realtime and vehicle position data is available for Jönköpings Länstrafik starting June 3rd 2024.
OperatorAbbreviationStatic dataReal-time dataVehicle positionsOccupancy data
Blekingetrafiken (Blekinge län)blekinge✔️
Dalatrafik (Dalarnas län)dt✔️✔️✔️
DinTur (Västernorrlands län)dintur✔️
Gotlands kollektivtrafik (Gotlands län)gotland✔️
Hallandstrafiken (Hallands län)halland✔️
JLT (Jönköpings län)jlt✔️✔️✔️
Kalmar länstrafik (Kalmar län)klt✔️✔️✔️
Kronobergs länstrafik (Kronobergs län)krono✔️✔️✔️
Länstrafiken Jämtlandjamtland✔️
Länstrafiken Norrbottennorrbotten✔️
Länstrafiken Västerbottenvasterbotten✔️🕒🕒
Länstrafiken Örebroorebro✔️✔️✔️
Skånetrafiken (Skåne län)skane✔️✔️✔️✔️
SL (Stockholms län)sl✔️✔️✔️
Sörmlandstrafiken (Södermanlands län)sormland✔️
UL (Uppsala län)ul✔️✔️✔️
VL (Västmanlands län)vastmanland✔️✔️✔️
Värmlandstrafik & Karlstadbuss (Värmlands län)varm✔️✔️✔️
Västtrafik (Västra götalands län)vt✔️
X-Trafik (Gävleborgs län)xt✔️✔️✔️
Östgötatrafiken (Östergötlands län)otraf✔️✔️✔️✔️
BT bussbtbuss✔️
Bussbolaget Östergötlandbussost✔️
Destination Gotlanddg✔️
Flixtrainflixtrain✔️
Härjedalingenharje✔️
Inlandsbananinban✔️
Lennakattenlenna✔️
Masexpressenmasen✔️
Ressel Rederiressel✔️
Roslagens sjötrafikroslagen✔️
SJsj✔️
Sjöstadstrafiken (Stockholm Stad)sjostadstrafiken✔️
Snälltågetsnalltaget✔️
Stavsnäs båttaxibattaxi✔️
Strömma Turism & Sjöfart ABstromma✔️
TJF Smalspårettjf✔️
Trosabussentrosa✔️
Tåg i Bergslagentib✔️
Tågabtagab✔️
Uddevalla Turism ABuddevalla✔️
VR (previously MTRX)vr✔️
Vy Nattågvy-nattag✔️
Vy Norrtågvy-norrtag✔️
Vy Tåg Värmlandstrafikvy-varmlandstrafik✔️
Vy Tåg X-tågetvy-xtaget✔️
Vygruppen Norgevy-norge✔️
Y-Bussybuss✔️

Breaking changes

This dataset has the stable status. This means that the fields can be added without prior warning, but when changes to existing fields are made, you will get three months to update your implementations.

Static data

The static NeTEx Regional dataset contains files describing all planned public transport data, with more technical details compared to the GTFS Regional feeds.

In order to retrieve the static data you need an API key. Technical details for fetching the data can be found in the API’s OpenAPI specification.

Where to download

The dataset can be accessed through the following URL:

https://opendata.samtrafiken.se/netex/{operator}/{operator}.zip?key={apikey}.

Replace {operator} with the abbreviation of the operator you want to download. These abbreviations can be found in the OpenAPI specification, but are also listed on the top of this page. Replace {apikey} with your own API key. If you don´t have a key yet, read here on how to get one.

API key levels

LevelMaximum calls per minuteMaximum calls per month
Bronze1050
Silver10250
Gold202500

Example download URLs

Below are some example download URLs. For a complete list all operators with data available, check the top of this page.

Regional operators

OperatorStatic data
Skånetrafiken (Skåne län)https://opendata.samtrafiken.se/netex/skane/skane.zip?key=
SL (Stockholm län)https://opendata.samtrafiken.se/netex/sl/sl.zip?key=
UL (Uppsala län)https://opendata.samtrafiken.se/netex/ul/ul.zip?key=
Östgötatrafiken (Östergötlands län)https://opendata.samtrafiken.se/netex/otraf/otraf.zip?key=

Commercial operators

OperatorStatic data
SJhttps://opendata.samtrafiken.se/netex/sj/sj.zip?key=

Realtime data (SIRI)

Service Interface for Real-time Information (SIRI) is a data-format for real-time data. This data contains updates and real-time changes to the static NeTEx data. The two data formats should be used together, since the real-time data refers to elements defined in the static data.

This SIRI feed is based on version 1.1 of the Norwegian SIRI profile. The profile is based on SIRI 2.0. The full profile documentation can be found here: https://enturas.atlassian.net/wiki/spaces/PUBLIC/pages/637370420/Norwegian+SIRI+profile

Availability of regional data differs per operator. See the top of this page to see which data is provided by the operator(s) you are interested in.

Where to download

The dataset can be accessed through the following URL:

Replace {operator} with the abbreviation of the operator you want to download. These abbreviations can be found in the OpenAPI specification, but are also listed on the top of this page. Replace {apikey} with your own API key. If you don´t have a key yet, read here on how to get one.

API key levels

LevelMaximum calls per minuteMaximum calls per month
Bronze5030 000
Silver2502 000 000
Gold50022 500 000

Available Siri data

Estimated Timetables (ET)

SIRI-ET is used to model the status of existing VehicleJourneys and to ensure that deviations from the planned data (for the same operating day) such as cancellations, additional departures, delays, detours and changes in stops, can be published on short notice. The data is linked to objects in the planned data by use of ID’s, which ensures data quality. For more information and technical specifications, see SIRI-ET.

Situation Exchange (SX)

SIRI-SX is used to model textual descriptions of disruptions, or deviations from the planned public transport information. The messages can be applied directly to stops, lines, vehicles etc. in the already existing public transport data by the use of ID references. For more information and technical specifications, see SIRI-SX.

Vehicle Monitoring (VM)

SIRI-VM is used to model vehicle-movements and their progress compared to a planned timetable. The data is linked to objects in the planned data by use of ID’s, which ensures data quality. For more information and technical specifications, see SIRI-VM.

Licence

Data from the NeTEx Regional API is available under the CC0 1.0 Universal (CC0 1.0) Public Domain Dedication license.

Summary

The person who associated a work with this deed has dedicated the work to the public domain by waiving all of his or her rights to the work worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.

Other Information

In no way are the patent or trademark rights of any person affected by CC0, nor are the rights that other persons may have in the work or in how the work is used, such as publicity or privacy rights.

Unless expressly stated otherwise, the person who associated a work with this deed makes no warranties about the work, and disclaims liability for all uses of the work, to the fullest extent permitted by applicable law.

When using or citing the work, you should not imply endorsement by the author or the affirmer.

More information, as well as the complete license text, can be found at

the creative commons website.

Image: Lars Dareberg, Skånetrafiken