NeTEx Sweden is a NeTEx feed of high quality. The feed contains all data present in GTFS Sweden, as well as additional data which can’t be represented in GTFS.

At the moment this dataset does not contain all of the public transport data of Sweden. If that is what you are looking for we recommend GTFS Sverige 2, which is much less detailed but does contain all of the public transport data of Sweden.

What does this dataset contain?

This dataset contains high quality detailed data in the NeTEx format. Realtime SIRI data is not available for the aggregated NeTEx data. If your use case requires real-time data, please use the regional NeTEx data or national GTFS data. This dataset is an aggregated dataset of all the different datasets in the Netex Regional API.

Data format

The data is in the NeTEx (Network and Timetable Exchange) format. This is a format in which all European operators have to publish their data. The data is aimed at both operator-to-traveller communication and internal communication between different organizations.

Updates

The static data in this dataset is updated on a daily basis, typically between 10:00 and 13:00.

Operators covered by this dataset

The following table shows which operators are covered by this dataset.

New! Realtime and vehicle position data is available for Jönköpings Länstrafik starting June 3rd 2024.
OperatorAbbreviationStatic dataReal-time dataVehicle positionsOccupancy data
Blekingetrafiken (Blekinge län)blekinge✔️
Dalatrafik (Dalarnas län)dt✔️✔️✔️
DinTur (Västernorrlands län)dintur✔️
Gotlands kollektivtrafik (Gotlands län)gotland✔️
Hallandstrafiken (Hallands län)halland✔️
JLT (Jönköpings län)jlt✔️✔️✔️
Kalmar länstrafik (Kalmar län)klt✔️✔️✔️
Kronobergs länstrafik (Kronobergs län)krono✔️✔️✔️
Länstrafiken Jämtlandjamtland✔️
Länstrafiken Norrbottennorrbotten✔️
Länstrafiken Västerbottenvasterbotten✔️🕒🕒
Länstrafiken Örebroorebro✔️✔️✔️
Skånetrafiken (Skåne län)skane✔️✔️✔️✔️
SL (Stockholms län)sl✔️✔️✔️
Sörmlandstrafiken (Södermanlands län)sormland✔️
UL (Uppsala län)ul✔️✔️✔️
VL (Västmanlands län)vastmanland✔️✔️✔️
Värmlandstrafik & Karlstadbuss (Värmlands län)varm✔️✔️✔️
Västtrafik (Västra götalands län)vt✔️
X-Trafik (Gävleborgs län)xt✔️✔️✔️
Östgötatrafiken (Östergötlands län)otraf✔️✔️✔️✔️
BT bussbtbuss✔️
Bussbolaget Östergötlandbussost✔️
Destination Gotlanddg✔️
Flixtrainflixtrain✔️
Härjedalingenharje✔️
Inlandsbananinban✔️
Lennakattenlenna✔️
Masexpressenmasen✔️
Ressel Rederiressel✔️
Roslagens sjötrafikroslagen✔️
SJsj✔️
Sjöstadstrafiken (Stockholm Stad)sjostadstrafiken✔️
Snälltågetsnalltaget✔️
Stavsnäs båttaxibattaxi✔️
Strömma Turism & Sjöfart ABstromma✔️
TJF Smalspårettjf✔️
Trosabussentrosa✔️
Tåg i Bergslagentib✔️
Tågabtagab✔️
Uddevalla Turism ABuddevalla✔️
VR (previously MTRX)vr✔️
Vy Nattågvy-nattag✔️
Vy Norrtågvy-norrtag✔️
Vy Tåg Värmlandstrafikvy-varmlandstrafik✔️
Vy Tåg X-tågetvy-xtaget✔️
Vygruppen Norgevy-norge✔️
Y-Bussybuss✔️

Breaking changes

This dataset has the stable status. This means that the fields can be added without prior warning, but when changes to existing fields are made, you will get three months to update your implementations.

Static data

The static NeTEx Sweden dataset contains files describing all planned public transport data, with more technical details compared to the GTFS Sweden feed but with the overall same timetable data.

In order to retrieve the static data you need an API key. Technical details for fetching the data can be found in the API’s OpenAPI specification.

To see which operators are included in this dataset see the table above.

Where to download

The dataset can be accessed through the following URL:

https://opendata.samtrafiken.se/netex-sweden/sweden.zip?key={apikey}.

Replace {apikey} with your own API key. If you don´t have a key yet, read here on how to get one.

API key levels

LevelMaximum calls per minuteMaximum calls per month
Bronze1050
Silver10250

Licence

Data from the NeTEx Sweden API is available under the CC0 1.0 Universal (CC0 1.0) Public Domain Dedication license.

Summary

The person who associated a work with this deed has dedicated the work to the public domain by waiving all of his or her rights to the work worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law.

Other Information

In no way are the patent or trademark rights of any person affected by CC0, nor are the rights that other persons may have in the work or in how the work is used, such as publicity or privacy rights.

Unless expressly stated otherwise, the person who associated a work with this deed makes no warranties about the work, and disclaims liability for all uses of the work, to the fullest extent permitted by applicable law.

When using or citing the work, you should not imply endorsement by the author or the affirmer.

More information, as well as the complete license text, can be found at

the creative commons website.

Image: Lars Dareberg, Skånetrafiken